PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc033509.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 260aa    MW: 29363.9 Da    PI: 7.5226
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc033509.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.41.8e-2141129191
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                              ++Yn+ A+++GFsvrk k+++   ++++++++f C+k g ++++ ++  ++  t+  t+tgC+a+ +  ++++gkw vtk ++eHn
  Itr_sc033509.1_g00001.1  41 DMYNDLASRMGFSVRKGKQYYFPGTRNVKSKKFHCYKAGLKTKQASA--NKCYTKIDTQTGCDAMCQFDLDSSGKWIVTKHVKEHN 124
                              58****************************************99988..8999********************************* PP

                     FAR1  87 Helap 91 
                              H l+p
  Itr_sc033509.1_g00001.1 125 HGLCP 129
                              ***96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-1842129IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
GCNPSAGGGG TSTDANEDDS SIPANQELVG HSVYSLEEAF DMYNDLASRM GFSVRKGKQY  60
YFPGTRNVKS KKFHCYKAGL KTKQASANKC YTKIDTQTGC DAMCQFDLDS SGKWIVTKHV  120
KEHNHGLCPA YASYMLRSHR NISVDQLTYL KDMKRSGVPL SDGIRFLKHQ SGGSPFVGFT  180
DRDAYNIMLL DSAKHLDGTD SNTLIEIFRK RQLNESGFFF YFEVDDDARL CSFFWRDVQM  240
KSDYLLFGDL VVHDTTYRTN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-28FAR1-related sequence 5